Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ANKRD5 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | ANKRD5 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP156450
|
Novus Biologicals
NBP156450 |
100 μL |
Each of 1 for $436.00
|
|
Description
ANKRD5 Polyclonal specifically detects ANKRD5 in Human samples. It is validated for Western Blot.Specifications
ANKRD5 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
ankyrin repeat domain 5, ankyrin repeat domain-containing protein 5, dJ839B4.6, FLJ21669 | |
ANKRD5 | |
IgG | |
Affinity Purified |
Western Blot | |
Unconjugated | |
RUO | |
Q9NU02 | |
63926 | |
Synthetic peptides corresponding to ANKRD5 (ankyrin repeat domain 5) The peptide sequence was selected from the middle region of ANKRD5)(50ug). Peptide sequence LDIGAKFQLENRKGHSAMDVAKAYADYRIIDLIKEKLDNLPKPAENQKLK. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title