Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ANKRD5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156444

 View more versions of this product

Catalog No. NBP156444

Add to Cart



ANKRD5 Polyclonal specifically detects ANKRD5 in Human samples. It is validated for Western Blot.


PBS, 2% Sucrose with 0.09% Sodium Azide
Synthetic peptides corresponding to ANKRD5 (ankyrin repeat domain 5) The peptide sequence was selected from the N terminal of ANKRD5. Peptide sequence MTIVDNEGKGVLFYCILPTKRHYRCALIALEHGADVNNSTYEGKPIFLRA.
Affinity purified
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot
0.5 mg/ml
Western Blot 1.0 ug/ml
ankyrin repeat domain 5, ankyrin repeat domain-containing protein 5, dJ839B4.6, FLJ21669
87 kDa
100 μL
Expected identity based on immunogen sequence: Canine: 100%; Equine: 100%; Human: 100%; Guinea pig: 92%; Mouse: 92%; Pig: 92%; Rabbit: 92%; Rat: 92%; Bovine: 85%.
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Product Suggestions

Product Suggestions



Product Certifications


Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit