ANKRD54 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157052

Catalog No. NBP157052

Description

ANKRD54 Polyclonal specifically detects ANKRD54 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ANKRD54
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ankyrin repeat domain 54, LIARankyrin repeat domain-containing protein 54
• Host Species: Rabbit
• Molecular Weight of Antigen: 33 kDa
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 129138
• Reconstitution: Centrifuge vial prior to reconstitution. Add 50μL distilled water to a final antibody concentration of 1mg/mL.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q6NXT1
• Gene Symbols: ANKRD54
• Immunogen: Synthetic peptides corresponding to ANKRD54 (ankyrin repeat domain 54) The peptide sequence was selected from the middle region of ANKRD54 (NP_620152). Peptide sequence EVHALKRLRDSANANDVETVQQLLEDGADPCAADDKGRTALHFASCNGND.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG