Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ANKRD65 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP191320

 View more versions of this product

Catalog No. NBP191320


Add to cart

Description

Description

ANKRD65 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

ANKRD65
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
ANKRD65
Synthetic peptide directed towards the N terminal of human hCG_20426 (XP_497648). Peptide sequence MDSQRPEPREEEEEEQELRWMELDSEEALGTRTEGPSVVQGWGHLLQAVW.
41 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Human: 100%.
Human
Western Blot
Western Blot 0.2-1 ug/ml
E5RJM6
ankyrin repeat domain 65, hypothetical protein LOC441869
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
441869
Centrifuge vial prior to reconstitution. Add 50μL distilled water to a final antibody concentration of 1mg/mL.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit