Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ANKRD65 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | ANKRD65 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP191321
|
Novus Biologicals
NBP191321 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
ANKRD65 Polyclonal specifically detects ANKRD65 in Human samples. It is validated for Western Blot.Specifications
ANKRD65 | |
Polyclonal | |
Rabbit | |
Human | |
441869 | |
Synthetic peptide directed towards the C terminal of human hCG_20426. Peptide sequence LAAERGHGPTVGLLLSRGASPTLRTQWAEVAQMPEGDLPQALPELGGGEK. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
ankyrin repeat domain 65, hypothetical protein LOC441869 | |
ANKRD65 | |
IgG |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title