Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Ankyrin 1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | Ankyrin 1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP155102
|
Novus Biologicals
NBP155102 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
Ankyrin 1 Polyclonal specifically detects Ankyrin 1 in Human samples. It is validated for Western Blot.Specifications
| Ankyrin 1 | |
| Polyclonal | |
| Rabbit | |
| P16157 | |
| 286 | |
| Synthetic peptides corresponding to ANK1(ankyrin 1, erythrocytic) The peptide sequence was selected from the middle region of ANK1 (NP_065210). Peptide sequence PCAMPETVVIRSEEQEQASKEYDEDSLIPSSPATETSDNISPVASPVHTG. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| ANK, ANK-1, ankyrin 1, erythrocytic, ankyrin-1, Ankyrin-R, Erythrocyte ankyrin, SPH1, SPH2 | |
| ANK1 | |
| IgG | |
| Affinity Purified | |
| 189 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title