Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Annexin A8 like2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen Annexin A8 like2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP1592820
View Documents
Novus Biologicals
NBP15912820UL
20 μL
Each for $152.22
Add to cart
 
NBP159128
View Documents
Novus Biologicals
NBP159128
100 μL
Each for $436.00
Add to cart
 
Description

Description

Annexin A8 like2 Polyclonal specifically detects Annexin A8 like2 in Human samples. It is validated for Western Blot.
Specifications

Specifications

Annexin A8 like2
Polyclonal
Rabbit
Q5VT79
244
Synthetic peptides corresponding to ANXA8L2(annexin A8-like 2) The peptide sequence was selected from the N terminal of ANXA8L2. Peptide sequence PDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAKSFKAQFGKDLTET.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
annexin A8L2, annexin A8-like 2, annexin A8-like protein 2, ANXA8, bA145E20.2, FLJ32754, FLJ54151
ANXA8L2
IgG
Affinity Purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit