Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ANO3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | ANO3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP17040920
|
Novus Biologicals
NBP17040920UL |
20 μL |
Each for $152.22
|
|
NBP170409
|
Novus Biologicals
NBP170409 |
100 μL |
Each for $436.00
|
|
Description
ANO3 Polyclonal specifically detects ANO3 in Human samples. It is validated for Western Blot.Specifications
ANO3 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
63982 | |
Synthetic peptides corresponding to TMEM16C(transmembrane protein 16C) The peptide sequence was selected from the middle region of TMEM16C. Peptide sequence WWSRHKIKRGIHDASIPQWENDWNLQPMNLHGLMDEYLEMVLQFGFTTIF. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
anoctamin 3, anoctamin-3, C11orf25, GENX-3947, TMEM16C | |
ANO3 | |
IgG | |
Affinity Purified | |
115 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title