Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant AASDHPPT.

Manufacturer:  Abnova Corporation H00060496A01

Catalog No. 89-004-701


Add to cart

Description

Description

The protein encoded by this gene is similar to Saccharomyces cerevisiae LYS5, which is required for the activation of the alpha-aminoadipate dehydrogenase in the biosynthetic pathway of lysine. Yeast alpha-aminoadipate dehydrogenase converts alpha-biosynthetic-aminoadipate semialdehyde to alpha-aminoadipate. It has been suggested that defects in the human gene result in pipecolic acidemia. [provided by RefSeq

Sequence: MVFPAKRFCLVPSMEGVRWAFSCGTWLPSRAEWLLAVRSIQPEEKERIGQFVFARDAKAAMAGRLMIRKLVAEKLNIPWNHIRLQRTAKGKPVLAKDSS
Specifications

Specifications

aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase
Unconjugated
50% glycerol
NM_015423
AASD-PPT|CGI-80|DKFZp566E2346|LYS2|LYS5
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
60496
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant AASDHPPT.
AASDHPPT
Serum
AASDHPPT
AASDHPPT (NP_056238, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit