ABCC2, Mouse, Clone: 1C5, Abnova™

Mouse monoclonal antibody raised against a partial recombinant ABCC2.

Manufacturer: Abnova Corporation H00001244M01A

Catalog No. 89-021-124

  Check Availability
Add to Cart

    Specifications

    Antigen ABCC2
    Applications Enzyme Linked Immunosorbent Assay,Sandwich ELISA,Western Blotting
    Clone 1C5
    Conjugate Unlabeled
    Cross Reactivity Human
    Description ATP-binding cassette, subfamily C (CFTR/MRP), member 2
    Format Liquid
    Formulation In ascites fluid
    Gene ABCC2
    Gene Accession No. NM_000392
    Gene Alias ABC30, CMOAT, DJS, KIAA1010, MRP2, cMRP
    Gene Symbols ABCC2
    Host Species Mouse
    Immunogen ABCC2 (NP_000383, 214 a.a. ∽314 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26kDa.
    Isotype IgG1, κ
    Quantity 200μL
    Regulatory Status RUO
    Species Reactivity Human
    Storage Requirements Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
    Primary or Secondary Primary
    Monoclonal or Polyclonal Monoclonal
    Gene ID (Entrez) 1244

    The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is expressed in the canalicular (apical) part of the hepatocyte and functions in biliary transport. Substrates include anticancer drugs such as vinblastine; therefore, this protein appears to contribute to drug resistance in mammalian cells. Several different mutations in this gene have been observed in patients with Dubin-Johnson syndrome (DJS), an autosomal recessive disorder characterized by conjugated hyperbilirubinemia. [provided by RefSeq

    Sequence: LKGYKRPLTLEDVWEVDEEMKTKTLVSKFETHMKRELQKARRALQRRQEKSSQQNSGARLPGLNKNQSQSQDALVLEDVEKKKKKSGTKKDVPKSWLMKA

  • Description & Specifications

Related Products


Product Content Feedback

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit