Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ankyrin repeat and BTB (POZ) domain containing 1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant ABTB1.

Manufacturer:  Abnova Corporation H00080325A01

Catalog No. 89-004-726


Add to cart

Description

Description

This gene encodes a protein with an ankyrin repeat region and two BTB/POZ domains, which are thought to be involved in protein-protein interactions. Expression of this gene is activated by the phosphatase and tensin homolog, a tumor suppressor. Alternate splicing results in three transcript variants encoding different isoforms. [provided by RefSeq

Sequence: CPDICFRVAGCSFLCHKAFFCGRSDYFRALLDDHFRESEEPATSGGPPAVTLHGISPDVFTHVLYYMYSDHTELSPEAAYDVLSVADMYLLPGLKRLCGR
Specifications

Specifications

ankyrin repeat and BTB (POZ) domain containing 1
Unconjugated
50% glycerol
NM_172027
BPOZ|Btb3|EF1ABP|MGC20585|PP2259
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
80325
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant ABTB1.
ABTB1
Serum
ABTB1
ABTB1 (NP_742024, 271 a.a. ~ 370 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit