Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

actin, gamma 2, smooth muscle, enteric, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant ACTG2.

Manufacturer:  Abnova Corporation H00000072A01

Catalog No. 89-004-003


Add to cart

Description

Description

Actins are highly conserved proteins that are involved in various types of cell motility, and maintenance of the cytoskeleton. In vertebrates, three main groups of actin isoforms, alpha, beta and gamma have been identified. The alpha actins are found in muscle tissues and are a major constituent of the contractile apparatus. The beta and gamma actins co-exist in most cell types as components of the cytoskeleton, and as mediators of internal cell motility. Actin, gamma 2, encoded by this gene, is a smooth muscle actin found in enteric tissues. [provided by RefSeq

Sequence: MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPE
Specifications

Specifications

actin, gamma 2, smooth muscle, enteric
Unconjugated
50% glycerol
NM_001615
ACT|ACTA3|ACTE|ACTL3|ACTSG
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
72
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant ACTG2.
ACTG2
Serum
ACTG2
ACTG2 (NP_001606, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human, Murine
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit