Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

anti-Adenylate Cyclase 7, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP214268

Catalog No. NBP214268


Add to cart

Description

Description

Adenylate Cyclase 7 Polyclonal specifically detects Adenylate Cyclase 7 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

Adenylate Cyclase 7
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Affinity Purified
ADCY7
This antibody was developed against Recombinant Protein corresponding to amino acids: PFAHLNHRESVSSGETHVPNGRRPKSVPQRHRRTPDRSMSPKGRSEDDSY DDEMLSAIEGLSSTRPCCSKSDDFYTFGSIFL
Immunogen affinity purified
RUO
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunohistochemistry, Immunohistochemistry (Paraffin)
Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
P51828
AC7, adenylate cyclase 7, adenylate cyclase type 7, Adenylate cyclase type VII, Adenylyl cyclase 7, ATP pyrophosphate-lyase 7, EC 4.6.1, EC 4.6.1.1, KIAA0037FLJ36387
Rabbit
IgG
0.1 ml
Lipid and Metabolism
Primary
113
Human
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only