Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

anti-Adiponutrin/PNPLA3, Polyclonal, Novus Biologicals™

Goat Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP130092

Catalog No. NBP130092


Add to cart

Description

Description

Adiponutrin/PNPLA3 Polyclonal antibody specifically detects Adiponutrin/PNPLA3 in Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

Adiponutrin/PNPLA3
1.0 mg/mL
Western Blot 1 ug/ml, Immunohistochemistry 4ug/ml, Immunohistochemistry-Paraffin 4ug/ml
Affinity Purified
PNPLA3
Synthetic peptide (CVRKARSRNIGTLHPFFNINKCIRDGLQESLPD) corresponding to aa 73-104 mouse Adiponutrin 3.
Immunogen affinity purified
RUO
Store at -80C. Avoid freeze-thaw cycles.
Polyclonal
VRKARSRNIGTLHPFFNINKCIRDGLQESLPD 73-104. Mouse Q91WW7
Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Unconjugated
PBS with 1 mg/ml BSA with 0.1% Sodium Azide
Acylglycerol O-acyltransferase, adiponutrin, ADPNdJ796I17.1, C22orf20, Calcium-independent phospholipase A2-epsilon, chromosome 22 open reading frame 20, EC 2.3.1.-, EC 2.7.7.56, EC 3.1.1.3, EC 4.2.3.4, FLJ22012, iPLA(2)epsilon, iPLA2-epsilon, patatin-like phospholipase domain containing 3, patatin-like phospholipase domain-containing protein 3
Goat
IgG
0.1 mg
Lipid and Metabolism
Primary
80339
Mouse
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only