Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

AgRP Guinea Pig anti-Mouse, Ovine, Rat, Polyclonal, Invitrogen™

Guinea Pig Polyclonal Antibody

Manufacturer:  Invitrogen PA118414

Catalog No. PIPA118414


Add to cart

Description

Description

PA1-18414 detects Agouti Related Protein from mouse, rat and ovine samples. PA1-18414 has been successfully used in immunohistochemistry (paraffin) and immunofluorescence applications. The PA1-18414 immunogen is a synthetic peptide (SPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT) corresponding to a region (82-131) within the carboxy domain of mouse agouti related protein conjugated to carrier protein. Reconstitute with 50 µL of distilled water.

Specifications

Specifications

AgRP
Polyclonal
whole serum with no preservative
P56473
Agrt, Art
Guinea Pig
IgG
RUO
Antibody
Polyclonal
Mouse, Ovine, Rat
Immunofluorescence, Immunohistochemistry (Paraffin)
Unconjugated
Agrp
Lyophilized
AGRP
Synthetic peptide corresponding to a region (82-131) within the carboxy domain of mouse agouti related protein conjugated to carrier protein.
50 μL
-20° C, Avoid Freeze/Thaw Cycles
Primary
11604, 25582, 443269
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit