AKR1C2 (M03), Mouse anti-Human, Clone: 3C11, Abnova™

Mouse monoclonal antibody raised against a partial recombinant AKR1C2.

Supplier:  Abnova Corporation H00001646M03

Catalog No. 89-021-277

Description

This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols using NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme binds bile acid with high affinity, and shows minimal 3-alpha-hydroxysteroid dehydrogenase activity. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. [provided by RefSeq

Sequence: EEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPVSDEY

Specifications

• Antigen: AKR1C2
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC063574
• Gene Symbols: AKR1C2
• Immunogen: AKR1C2 (AAH63574, 224 a.a. ∼ 323 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2a κ

• Applications: ELISA, Western Blot
• Clone: 3C11
• Description: Mouse monoclonal antibody raised against a partial recombinant AKR1C2.
• Gene: AKR1C2
• Gene Alias: AKR1C-pseudo/BABP/DD/DD2/DDH2/HAKRD/HBAB/MCDR2
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 1646
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid