AKT2, Mouse, Clone: 1B3, Abnova™

Mouse monoclonal antibody raised against a partial recombinant AKT2.

Supplier:  Abnova Corporation H00000208M01

Catalog No. 89-016-100

Description

This gene is a putative oncogene encoding a protein belonging to a subfamily of serine/threonine kinases containing SH2-like (Src homology 2-like) domains. The gene was shown to be amplified and overexpressed in 2 of 8 ovarian carcinoma cell lines and 2 of 15 primary ovarian tumors. Overexpression contributes to the malignant phenotype of a subset of human ductal pancreatic cancers. The encoded protein is a general protein kinase capable of phophorylating several known proteins. [provided by RefSeq

Sequence: MRAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVII

Specifications

• Antigen: AKT2
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: M95936
• Gene Symbols: AKT2
• Immunogen: AKT2 (AAA58364, 100 a.a. ∼ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG1 κ

• Applications: ELISA, Immunofluorescence, Western Blot
• Clone: 1B3
• Description: Mouse monoclonal antibody raised against a partial recombinant AKT2.
• Gene: AKT2
• Gene Alias: PKBB/PKBBETA/PRKBB/RAC-BETA
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 208
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid