amelogenin (amelogenesis imperfecta 1, X-linked), Mouse, Clone: 3B5, Abnova™

Mouse monoclonal antibody raised against a partial recombinant AMELX.

Manufacturer: Abnova Corporation H00000265M03

Catalog No. 89-000-517

  Check Availability
Add to Cart

    Specifications

    Antigen amelogenin (amelogenesis imperfecta 1, X-linked)
    Applications Enzyme Linked Immunosorbent Assay,Western Blotting
    Clone 3B5
    Conjugate Unlabeled
    Cross Reactivity Human
    Description amelogenin (amelogenesis imperfecta 1, X-linked)
    Format Affinity Purified
    Formulation In 1X PBS, pH 7.4
    Gene AMELX
    Gene Accession No. NM_001142
    Gene Alias AIH1, ALGN, AMG, AMGL, AMGX
    Gene Symbols AMELX
    Host Species Mouse
    Immunogen AMELX (NP_001133, 93 a.a. ∽192 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
    Isotype IgG2b
    Purification Method Protein A column
    Quantity 50μg
    Regulatory Status RUO
    Species Reactivity Human
    Storage Requirements Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
    Whole Molecule Y
    Primary or Secondary Primary
    Monoclonal or Polyclonal Monoclonal
    Gene ID (Entrez) 265

    This gene encodes a member of the amelogenin family of extracellular matrix proteins. Amelogenins are involved in biomineralization during tooth enamel development. Mutations in this gene cause X-linked amelogenesis imperfecta. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq

    Sequence: PVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD

  • Description & Specifications

Related Products


Product Content Feedback

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit