AMPD2, Mouse, Clone: 6A8, Abnova™

Mouse monoclonal antibody raised against a partial recombinant AMPD2.

Manufacturer: Abnova Corporation H00000271M09

Catalog No. 89-016-142

  Check Availability
Add to Cart

    Specifications

    Antigen AMPD2
    Applications Enzyme Linked Immunosorbent Assay,Western Blotting
    Clone 6A8
    Conjugate Unlabeled
    Cross Reactivity Human
    Description adenosine monophosphate deaminase 2 (isoform L)
    Format Liquid
    Formulation In 1X PBS, pH 7.4
    Gene AMPD2
    Gene Accession No. NM_139156
    Gene Symbols AMPD2
    Host Species Mouse
    Immunogen AMPD2 (NP_631895, 86 a.a. ∽186 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26kDa.
    Isotype IgG2a, κ
    Quantity 50μg
    Regulatory Status RUO
    Species Reactivity Human
    Storage Requirements Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
    Primary or Secondary Primary
    Monoclonal or Polyclonal Monoclonal
    Gene ID (Entrez) 271

    Adenosine monophosphate deaminase-2 (EC 3.5.4.6) catalyzes the deamination of AMP to IMP and plays an important role in the purine nucleotide cycle.[supplied by OMIM

    Sequence: ISQDVKLEPDILLRAKQDFLKTDSDSDLQLYKEQGEGQGDRSLRERDVLEREFQRVTISGEEKCGVPFTDLLDAAKSVVRALFIREKYMALSLQSFCPTT

  • Description & Specifications

Related Products


Product Content Feedback

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit