Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

anaphase promoting complex subunit 10 (B01), Mouse anti-Human, Rat, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human ANAPC10 protein.

Manufacturer:  Abnova Corporation H00010393B01

Catalog No. 89-006-970


Add to cart

Description

Description

Sequence: MTTPNKTPPGADPKQLERAGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYAPVEESSIGKFPRCTTIDFMMYRSIR
Specifications

Specifications

anaphase promoting complex subunit 10
Unconjugated
No additive
BC005217
APC10|DKFZp564L0562|DOC1
Mouse
50 uL
Cell Cycle
Y
Polyclonal
Human
Western Blot
Mouse polyclonal antibody raised against a full-length human ANAPC10 protein.
ANAPC10
Serum
ANAPC10
ANAPC10 (AAH05217, 1 a.a. ~ 185 a.a) full-length human protein.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
10393
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit