Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ANKRD11 Rabbit anti-Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP152984

Catalog No. NBP152984


Add to cart

Description

Description

ANKRD11 Polyclonal antibody specifically detects ANKRD11 in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).
Specifications

Specifications

ANKRD11
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Purified
ANKRD11
Synthetic peptides corresponding to ANKRD11 (ankyrin repeat domain 11) The peptide sequence was selected from the N terminal of ANKRD11 (NP_037407). Peptide sequence: KRKLPFTAGANGEQKDSDTEKQGPERKRIKKEPVTRKAGLLFGMGLSGIR.
298 kDa
100ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Zebrafish: 86%.
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Western Blot 1.25 ug/ml, Immunohistochemistry 4-8 ug/ml, Immunohistochemistry-Paraffin 4-8 ug/ml
Q6UB99
ANCO-1, ANCO1ankyrin repeat domain-containing protein 11, ankyrin repeat domain 11, Ankyrin repeat-containing cofactor 1, ankyrin repeat-containing protein 11, LZ16, nasopharyngeal carcinoma susceptibility protein, T13
Rabbit
IgG
Protein A purified
RUO
Primary
29123
Centrifuge vial prior to reconstitution. Add 100μL distilled water to a final antibody concentration of 1mg/mL.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only