AOC3, Mouse, Clone: 4B8, Abnova™

Mouse monoclonal antibody raised against a partial recombinant AOC3.

Supplier:  Abnova Corporation H00008639M06

Catalog No. 89-002-732

Description

Copper amine oxidases catalyze the oxidative conversion of amines to aldehydes in the presence of copper and quinone cofactor. The product is a major protein on the adipocyte plasma membrane. It has adhesive properties and also has functional monoamine oxidase activity. A pseudogene for this gene has been discribed and is located approximately 9kb downstream. [provided by RefSeq

Sequence: DVRFQGERLVYEISLQEALAIYGGNSPAAMTTRYVDGGFGMGKYTTPLTRGVDCPYLATYVDWHFLLESQAPKTIRDAFCVFEQNQGLPLRRHHSDLYSH

Specifications

• Antigen: AOC3,
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_003734
• Gene Symbols: AOC3
• Immunogen: AOC3 (NP_003725, 351 a.a. ∼ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2a κ

• Applications: ELISA, Immunofluorescence
• Clone: 4B8
• Description: Mouse monoclonal antibody raised against a partial recombinant AOC3.
• Gene: AOC3
• Gene Alias: HPAO/SSAO/VAP-1/VAP1
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 8639
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid