Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

AOC3, Mouse, Clone: 4B8, Abnova™

Mouse monoclonal antibody raised against a partial recombinant AOC3.

Manufacturer:  Abnova Corporation H00008639M06

Catalog No. 89-002-732


Add to cart

Description

Description

Copper amine oxidases catalyze the oxidative conversion of amines to aldehydes in the presence of copper and quinone cofactor. The product is a major protein on the adipocyte plasma membrane. It has adhesive properties and also has functional monoamine oxidase activity. A pseudogene for this gene has been discribed and is located approximately 9kb downstream. [provided by RefSeq

Sequence: DVRFQGERLVYEISLQEALAIYGGNSPAAMTTRYVDGGFGMGKYTTPLTRGVDCPYLATYVDWHFLLESQAPKTIRDAFCVFEQNQGLPLRRHHSDLYSH
Specifications

Specifications

AOC3,
4B8
Mouse monoclonal antibody raised against a partial recombinant AOC3.
AOC3
Liquid
AOC3
AOC3 (NP_003725, 351 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
100 ug
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Monoclonal
Human
ELISA, Immunofluorescence
Unconjugated
In 1X PBS, pH 7.4
NM_003734
HPAO|SSAO|VAP-1|VAP1
Mouse
IgG2a Kappa
RUO
Primary
8639
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit