Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
APEH Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP154954
Description
APEH Polyclonal antibody specifically detects APEH in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin).Specifications
APEH | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
AARE, ACPH, acylamino-acid-releasing enzyme, acylaminoacyl-peptidase, Acyl-peptide hydrolase, APH, D3F15S2, D3S48EEC 3.4.19.1, DNF15S2, MGC2178, N-acylaminoacyl-peptide hydrolase, OPH, Oxidized protein hydrolase | |
Rabbit | |
81 kDa | |
100 μL | |
GPCR, Stem Cell Markers | |
327 | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin) | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry-Paraffin | |
P13798 | |
APEH | |
Synthetic peptide directed towards the N terminal of human APEH (NP_001631). Peptide sequence VYEDDCFGCLSWSHSETHLLYVAEKKRPKAESFFQTKALDVSASDDEIAR. | |
Affinity purified | |
RUO | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?
Provide Content Correction