APOC2, Mouse, Clone: 3E4, Abnova™

Mouse monoclonal antibody raised against a partial recombinant APOC2.

Supplier:  Abnova Corporation H00000344M01

Catalog No. 89-016-176

Description

The protein encoded by this gene is secreted in plasma where it is a component of very low density lipoprotein. This protein activates the enzyme lipoprotein lipase, which hydrolyzes triglycerides and thus provides free fatty acids for cells. Mutations in this gene cause hyperlipoproteinemia type IB, characterized by hypertriglyceridemia, xanthomas, and increased risk of pancreatitis and early atherosclerosis. [provided by RefSeq

Sequence: TQQPQQDEMPSPTLLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE

Specifications

• Antigen: APOC2
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC005348
• Gene Symbols: APOC2
• Immunogen: APOC2 (AAH05348, 23 a.a. ∼ 101 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2a κ

• Applications: ELISA, Western Blot
• Clone: 3E4
• Description: Mouse monoclonal antibody raised against a partial recombinant APOC2.
• Gene: APOC2
• Gene Alias: MGC75082
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 344
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid