Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ARID5A Rabbit anti-Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP179441

Catalog No. NBP179441


Add to cart

Description

Description

ARID5A Polyclonal antibody specifically detects ARID5A in Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).
Specifications

Specifications

ARID5A
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
ARID5A
Synthetic peptide directed towards the C terminal of human ARID5AThe immunogen for this antibody is ARID5A. Peptide sequence MAAGLMHFPPTSFDSALRHRLCPASSAWHAPPVTTYAAPHFFHLNTKL.
64 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Bovine 86%.
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat
Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Western Blot 1:1000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 5 ug/ml
NP_997646
ARID domain-containing protein 5A, AT rich interactive domain 5A (MRF1-like), AT-rich interactive domain-containing protein 5A, RFVG5814
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
10865
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only