Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ADP-ribosylation factor-like 3, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human ARL3 protein.

Manufacturer:  Abnova Corporation H00000403B02

Catalog No. 89-004-937


Add to cart

Description

Description

ADP-ribosylation factor-like 3 is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL3 binds guanine nucleotides but lacks ADP-ribosylation factor activity. [provided by RefSeq

Sequence: MGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKKK
Specifications

Specifications

ADP-ribosylation factor-like 3
Unconjugated
No additive
NM_004311
ARFL3
Mouse
50 uL
Signal Transduction
Y
Polyclonal
Human
Immunofluorescence, Western Blot
Mouse polyclonal antibody raised against a full-length human ARL3 protein.
ARL3
Serum
ARL3
ARL3 (NP_004302, 1 a.a. ~ 182 a.a) full-length human protein.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
403
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit