Aspartate Aminotransferase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 8 publications

Supplier:  Novus Biologicals NBP154778

Catalog No. NBP154778

Description

Aspartate Aminotransferase Polyclonal specifically detects Aspartate Aminotransferase in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Aspartate Aminotransferase
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: aspartate aminotransferase, cytoplasmic, EC 2.6.1.1, GIG18, Glutamate oxaloacetate transaminase 1, glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1), growth-inhibiting protein 18, Transaminase A
• Host Species: Rabbit
• Molecular Weight of Antigen: 46 kDa
• Quantity: 100 μL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 2805
• Target Species: Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Goat, Rabbit, Yeast, Zebrafish
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
• Gene Accession No.: P17174
• Gene Symbols: GOT1
• Immunogen: Synthetic peptides corresponding to GOT1(glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1)) The peptide sequence was selected from the N terminal of GOT1 (NP_002070). Peptide sequence MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge at 12,000 x g for 20 seconds. Reconstitute with 0.1 ml distilled water to a final concentration of 1.0 mg/ml in PBS buffer. Vortex followed by centrifuge again to pellet the solution.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only