Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

anti-Aspartate Aminotransferase, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$397.50

Specifications

Host Species Rabbit
Isotype IgG
Immunogen Synthetic peptides corresponding to GOT1(glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1)) The peptide sequence was selected from the N terminal of GOT1 (NP_002070). Peptide sequence MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAY
Antigen Aspartate Aminotransferase
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP154778
View Documents
Novus Biologicals
NBP154778
100 ul
Each for $397.50
Add to cart
 
Description

Description

Aspartate Aminotransferase Polyclonal antibody specifically detects Aspartate Aminotransferase in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

Rabbit
Synthetic peptides corresponding to GOT1(glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1)) The peptide sequence was selected from the N terminal of GOT1 (NP_002070). Peptide sequence MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAY
Polyclonal
Primary
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
2805
Centrifuge at 12,000 x g for 20 seconds. Reconstitute with 0.1 ml distilled water to a final concentration of 1.0 mg/ml in PBS buffer. Vortex followed by centrifuge again to pellet the solution.
IgG
Aspartate Aminotransferase
Purified
RUO
P17174
PBS and 2% Sucrose with 0.09% Sodium Azide
SDS
Product Certifications

For Research Use Only

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit