ATP2A1, Mouse, Clone: 4B8, Abnova™

Mouse monoclonal antibody raised against a partial recombinant ATP2A1.

Manufacturer: Abnova Corporation H00000487M05

Catalog No. 89-016-266

  Check Availability
Add to Cart

    Specifications

    Antigen ATP2A1
    Applications Enzyme Linked Immunosorbent Assay,Western Blotting
    Clone 4B8
    Conjugate Unlabeled
    Cross Reactivity Human
    Description ATPase, Ca++ transporting, cardiac muscle, fast twitch 1
    Format Liquid
    Formulation In 1X PBS, pH 7.4
    Gene ATP2A1
    Gene Accession No. NM_173201
    Gene Alias ATP2A, SERCA1
    Gene Symbols ATP2A1
    Host Species Mouse
    Immunogen ATP2A1 (NP_775293, 522 a.a. ∽613 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26kDa
    Isotype IgG3, κ
    Quantity 50μg
    Regulatory Status RUO
    Species Reactivity Human
    Storage Requirements Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
    Primary or Secondary Primary
    Monoclonal or Polyclonal Monoclonal
    Gene ID (Entrez) 487

    This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in muscular excitation and contraction. Mutations in this gene cause some autosomal recessive forms of Brody disease, characterized by increasing impairment of muscular relaxation during exercise. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq

    Sequence: IDRCNYVRVGTTRVPLTGPVKEKIMAVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSARFLEYETDLTFVGVVGMLDPPRKEVTGSIQ

  • Description & Specifications

Related Products


Product Content Feedback

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit