Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ATP2A1, Mouse, Clone: 4B8, Abnova™

Mouse monoclonal antibody raised against a partial recombinant ATP2A1.

Manufacturer:  Abnova Corporation H00000487M05

Catalog No. 89-016-266


  Check Availability
Add to cart

Specifications

Description

This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in muscular excitation and contraction. Mutations in this gene cause some autosomal recessive forms of Brody disease, characterized by increasing impairment of muscular relaxation during exercise. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq

Sequence: IDRCNYVRVGTTRVPLTGPVKEKIMAVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSARFLEYETDLTFVGVVGMLDPPRKEVTGSIQ
Description & Specifications

Specifications

ATP2A1
4B8
Human
Liquid
ATP2A1
ATP2A, SERCA1
Murine
IgG3, κ
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Monoclonal
Human
ELISA,Western Blot
Unlabeled
ATPase, Ca++ transporting, cardiac muscle, fast twitch 1
In 1X PBS, pH 7.4
NM_173201
ATP2A1
ATP2A1 (NP_775293, 522 a.a. ∽613 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26kDa
50μg
Human
Primary
487
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit