ATP6AP1, Mouse, Clone: 3A2, Abnova™

Mouse monoclonal antibody raised against a partial recombinant ATP6AP1.

Supplier:  Abnova Corporation H00000537M01

Catalog No. 89-016-284

Description

This gene encodes a component of a multisubunit enzyme (1mDa MW) that mediates acidification of eukaryotic intracellular organelles. Vacuolar ATPase (V-ATPase) is comprised of a cytosolic V1 (site of the ATP catalytic site) and a transmembrane V0 domain. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, and receptor-mediated endocytosis. The encoded protein of this gene is approximately 45kDa and may assist in the V-ATPase-mediated acidification of neuroendocrine secretory granules. [provided by RefSeq

Sequence: SSDRDLWAPAADTHEGHITSDLQLSTYLDPALELGPRNVLLFLQDKLSIEDFTAYGGVFGNKQDSAFSNLENALDLAPSSLVLPAVDWYAVSTLTTYLQE

Specifications

• Antigen: ATP6AP1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_001183
• Gene Symbols: ATP6AP1
• Immunogen: ATP6AP1 (NP_001174, 51 a.a. ∼ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG1 κ

• Applications: ELISA, Western Blot
• Clone: 3A2
• Description: Mouse monoclonal antibody raised against a partial recombinant ATP6AP1.
• Gene: ATP6AP1
• Gene Alias: 16A/ATP6IP1/ATP6S1/Ac45/CF2/MGC129781/VATPS1/XAP-3/XAP3
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 537
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid