BarH-like homeobox 1, Mouse, Clone: 2B11, Abnova™

Mouse monoclonal antibody raised against a partial recombinant BARHL1.

Supplier:  Abnova Corporation H00056751M01

Catalog No. 89-001-322

Description

Sequence: GRDCLETGTPRPGGASGPGLDSHLQPGQLSAPAQSRTVTSSFLIRDILADCKPLAACAPYSSSGQPAAPEPGGRLAAKAAEDFRDKLDKSGSNASSDSEY

Specifications

• Antigen: BarH-like homeobox 1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_020064
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 2B11
• Description: Mouse monoclonal antibody raised against a partial recombinant BARHL1.
• Gene: BARHL1
• Gene Symbols: BARHL1
• Immunogen: BARHL1 (NP_064448, 55 a.a. ∼ 154 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Whole Molecule: Yes
• Gene ID (Entrez): 56751
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ