Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

anti-Beta Lactamase, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP191701

Catalog No. NBP191701


Add to cart

Description

Description

Beta Lactamase Polyclonal antibody specifically detects Beta Lactamase in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications

Specifications

Beta Lactamase
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
AmpC, EC 3.4, FLJ14902, G24, lactamase, beta, mitochondrial 39S ribosomal protein L56, mitochondrial ribosomal protein L56, MRPL56, serine beta lactamase-like protein LACTB, serine beta-lactamase-like protein LACTB, mitochondrial
Rabbit
IgG
0.1 ml
Virology Bacteria and Parasites
Primary
114294
Human, Mouse, Rat
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Affinity Purified
LACTB
This antibody was developed against Recombinant Protein corresponding to amino acids:KEGKSNEKNDFTKFKTEQENEAKCRNSKPGKKKNDFEQGELYLREKFENSIESLRLFKNDPLFFKPGSQFLYSTFGYTLL
Immunogen affinity purified
RUO
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only