Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

BCL2/adenovirus E1B 19kDa interacting protein 1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human BNIP1 protein.

Manufacturer:  Abnova Corporation H00000662B01

Catalog No. 89-004-985


Add to cart

Description

Description

This gene is a member of the BCL2/adenovirus E1B 19kDa-interacting protein (BNIP) family. It interacts with the E1B 19kDa protein which is responsible for the protection of virally-induced cell death, as well as E1B 19kDa-like sequences of BCL2, also an apoptotic protector. Alternative splicing of this gene results in four protein products with identical N- and C-termini. [provided by RefSeq

Sequence: MAAPQDVHVRICNQEIVKFDLEVKALIQDIRDCSGPLSALTELNTKVKEKFQQLRHRIQDLEQLAKEQDKESEKQLLLQEVENHKKQMLSNQASWRKANLTCKIAIDNLEKAELLQGGDLLRQRKTTKESLAQTSSTITESLMGISRMMAQQVQQSEEAMQSLVTSSRTILDANEEFKSMSGTIQLGRKLITKYNRRELTDKLLIFLALALFLATVLYIVKKRLFPFL
Specifications

Specifications

BCL2/adenovirus E1B 19kDa interacting protein 1
Unconjugated
No additive
BC010959
NIP1|SEC20|TRG-8
Mouse
50 uL
Apoptosis
Y
Polyclonal
Human
Western Blot
Mouse polyclonal antibody raised against a full-length human BNIP1 protein.
BNIP1
Serum
BNIP1
BNIP1 (AAH10959, 1 a.a. ~ 228 a.a) full-length human protein.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
662
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit