BRF1, Mouse, Clone: 2E9, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant BRF1.

Manufacturer: Abnova Corporation H00002972M01A

Catalog No. 89-022-427

  Check Availability
Add to Cart

    Specifications

    Antigen BRF1
    Applications Enzyme Linked Immunosorbent Assay,Western Blotting
    Clone 2E9
    Conjugate Unlabeled
    Cross Reactivity Human
    Description BRF1 homolog, subunit of RNA polymerase III transcription initiation factor IIIB (S. cerevisiae)
    Format Liquid
    Formulation In ascites fluid
    Gene BRF1
    Gene Accession No. BC016743
    Gene Alias BRF, FLJ42674, FLJ43034, GTF3B, MGC105048, TAF3B2, TAF3C, TAFIII90, TF3B90, TFIIIB90, hBRF
    Gene Symbols BRF1
    Host Species Mouse
    Immunogen BRF1 (AAH16743, 1 a.a. ∽ 208 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
    Isotype IgG1, κ
    Quantity 200μL
    Regulatory Status RUO
    Species Reactivity Human
    Storage Requirements Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
    Primary or Secondary Primary
    Monoclonal or Polyclonal Monoclonal
    Gene ID (Entrez) 2972

    This gene encodes one of the three subunits of the RNA polymerase III transcription factor complex. This complex plays a central role in transcription initiation by RNA polymerase III on genes encoding tRNA, 5S rRNA, and other small structural RNAs. The gene product belongs to the TF2B family. Two alternatively spliced variants encoding different isoforms, that function at different promoters transcribed by RNA polymerase III, have been identified. Other transcript variants are possible, but their full-length natures have not been completely characterized. [provided by RefSeq

    Sequence: MTGRVCRGCGGTDIELDAARGDTVCTACGSVLEDNIIMSEVQFVESSGGGSSAVGQFVSLDGAGKTPTLGGGFHVNLGKESRAQTLQNGRRHIHHLGNQLQLNQHCLDTAFNFFKMAVSRHLTRGRKMAHVIAACLYPVCRTEGTPHMLLDLSDLLQVDSLRPASFPTWGCDLGVVTRVVTGVYPRCLHASQWPVCAACPVRKFWSVG

  • Description & Specifications

Related Products


Product Content Feedback

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit