Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

BRF1, Mouse, Clone: 2E9, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant BRF1.

Manufacturer:  Abnova Corporation H00002972M01A

Catalog No. 89-022-427


  Check Availability
Add to cart

Specifications

Description

This gene encodes one of the three subunits of the RNA polymerase III transcription factor complex. This complex plays a central role in transcription initiation by RNA polymerase III on genes encoding tRNA, 5S rRNA, and other small structural RNAs. The gene product belongs to the TF2B family. Two alternatively spliced variants encoding different isoforms, that function at different promoters transcribed by RNA polymerase III, have been identified. Other transcript variants are possible, but their full-length natures have not been completely characterized. [provided by RefSeq

Sequence: MTGRVCRGCGGTDIELDAARGDTVCTACGSVLEDNIIMSEVQFVESSGGGSSAVGQFVSLDGAGKTPTLGGGFHVNLGKESRAQTLQNGRRHIHHLGNQLQLNQHCLDTAFNFFKMAVSRHLTRGRKMAHVIAACLYPVCRTEGTPHMLLDLSDLLQVDSLRPASFPTWGCDLGVVTRVVTGVYPRCLHASQWPVCAACPVRKFWSVG
Description & Specifications

Specifications

BRF1
2E9
BRF1 homolog, subunit of RNA polymerase III transcription initiation factor IIIB (S. cerevisiae)
BRF1
Liquid
BRF1
BRF1 (AAH16743, 1 a.a. ∽ 208 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
200μL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Monoclonal
Human
ELISA,Western Blot
Unlabeled
In ascites fluid
BC016743
BRF, FLJ42674, FLJ43034, GTF3B, MGC105048, TAF3B2, TAF3C, TAFIII90, TF3B90, TFIIIB90, hBRF
Murine
IgG1, κ
RUO
Primary
2972
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit