Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BRM Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP180042
Description
BRM Polyclonal specifically detects BRM in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
BRM | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
SMARCA2 | |
Synthetic peptide directed towards the middle region of human SMARCA2. Peptide sequence VINYKDSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKY. | |
Affinity purified | |
RUO | |
6595 | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
ATP-dependent helicase SMARCA2, BAF190B, BRG1-associated factor 190B, BRMFLJ36757, EC 3.6.1, EC 3.6.4.-, global transcription activator homologous sequence, hBRMMGC74511, hSNF2a, probable global transcription activator SNF2L2, Protein brahma homolog, SNF2, SNF2/SWI2-like protein 2, SNF2A, SNF2-alpha, SNF2L2BAF190, SNF2LA, SNF2-like 2, Sth1p, subfamily a, member 2, sucrose nonfermenting 2-like protein 2, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, SWI/SNF-related matrix-associated actin-dependent regulator of chromatin a2, SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily A member 2, SWI2 | |
Rabbit | |
32 kDa | |
100 μL | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?
Provide Content Correction