Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

chromosome 10 open reading frame 81, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human C10orf81 protein.

Manufacturer:  Abnova Corporation H00079949B01

Catalog No. 89-008-222


Add to cart

Description

Description

Sequence: MEQSSPGFRQTHLQDLSEATQDVKEENHYLTPRSVLLELDNIIASSDSGESIETDGPDQVSGRIECHYEPMESYFFKETSHESVDSSKEEPQTLPETQDGDLHLQEQGSGIDWCLSPADVEAQTTNDQKGSASLTVVQLSILINNIPDESQVEKLNVFLSPPDVINYLALTEATGRICVSQWEGPRRLGCIFCHGDHLLAVNDLKPQSLEEVSLFLTRSIQKEKLKLTIGRIPNSETFHAASCMCPSKCQSAAPSQLDKPRLNRAPKRSPAIKKSQQKGARE
Specifications

Specifications

chromosome 10 open reading frame 81
Polyclonal
Mouse polyclonal antibody raised against a full-length human C10orf81 protein.
C10orf81
FLJ23537/HEL185/bA211N11.2
Mouse
50 μL
Yes
79949
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Immunofluorescence, Western Blot
Unconjugated
No additive
BC036365
C10orf81
C10orf81 (AAH36365, 1 a.a. ∼ 282 a.a) full-length human protein.
RUO
Primary
Human
Serum
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit