Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

chromosome 21 open reading frame 33, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant C21orf33.

Manufacturer:  Abnova Corporation H00008209A01

Catalog No. 89-004-384


Add to cart

Description

Description

Sequence: RGVEVTVGHEQEEGGKWPYAGTAEAIKALGAKHCVKEVVEAHVDQKNKVVTTPAFMCETALHYIHDGIGAMVRKVLELTGK
Specifications

Specifications

chromosome 21 open reading frame 33
Unconjugated
50% glycerol
NM_004649
D21S2048E|ES1|GT335|HES1|KNP-I|KNPH|KNPI
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
8209
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant C21orf33.
C21orf33
Serum
C21orf33
C21orf33 (NP_004640, 188 a.a. ~ 268 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human, Murine
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit