Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TMEM103 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Supplier: Novus Biologicals NBP191733
Description
TMEM103 Polyclonal specifically detects TMEM103 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
C3orf75/ELP6 | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
Angiotonin-transactivated protein 1, ATP1, C3orf75, chromosome 3 open reading frame 75, elongator acetyltransferase complex subunit 6, ELP6, FLJ20211, Protein TMEM103, TMEM103, transmembrane protein 103 | |
Rabbit | |
Affinity Purified | |
RUO | |
54859 | |
Human | |
IgG |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
ELP6 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:VCWELKGNMVVLVHDSGDAEDEENDILLNGLSHQSHLILRAEGLATGFCRDVHGQLRILWRRPSQPAVHRDQ | |
0.1 mL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?
Provide Content Correction