Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CALB1, Mouse, MaxPab™ Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human CALB1 protein.

Manufacturer:  Abnova Corporation H00000793B01

Catalog No. 89-002-669


Add to cart

Description

Description

Calbindin is a calcium-binding protein belonging to the troponin C superfamily. It was originally described as a 27kDa protein induced by vitamin D in the duodenum of the chick. In the brain, its synthesis is independent of vitamin-D-derived hormones. Calbindin contains 4 active calcium-binding domains, and 2 modified domains that presumably have lost their calcium-binding capacity. The neurons in brains of patients with Huntington disease are calbindin-depleted. [provided by RefSeq

Sequence: MAESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKTFVDQYGQRDDGKIGIVELAHVLPTEENFLLLFRCQQLKSCEEFMKTWRKYDTDHSGFIETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLKFQGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIMALSDGGKLYRTDLALILCAGDN
Specifications

Specifications

CALB1
Unconjugated
No additive
NM_004929
CALB
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
Western Blot
Mouse polyclonal antibody raised against a full-length human CALB1 protein.
CALB1
Liquid
CALB1
CALB1 (NP_004920, 1 a.a. ~ 261 a.a) full-length human protein.
RUO
Primary
793
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit