Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CART, Mouse, Clone: 3E4, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant CART.

Manufacturer:  Abnova Corporation H00009607M01

Catalog No. 89-002-749


Add to cart

Description

Description

CART appears to have roles in reward, feeding, and stress, and it has the functional properties of an endogenous psychostimulant (Kuhar et al., 2002 [PubMed 12147208]).[supplied by OMIM

Sequence: MESSRVRLLPLLGAALLLMLPLLGTRAQEDAELQPRALDIYSAVDDASHEKELIEALQEVLKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL
Specifications

Specifications

CART,
3E4
Mouse monoclonal antibody raised against a full-length recombinant CART.
CARTPT
Liquid
CARTPT
CART (AAH29882, 1 a.a. ~ 116 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
100 ug
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Monoclonal
Human
ELISA, Western Blot
Unconjugated
In 1X PBS, pH 7.4
BC029882
CART
Mouse
IgG2a Kappa
RUO
Primary
9607
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit