Casein Kinase 2 alpha Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155002

Catalog No. NBP155002

Description

Casein Kinase 2 alpha Polyclonal specifically detects Casein Kinase 2 alpha in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Casein Kinase 2 alpha
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: casein kinase 2, alpha 1 polypeptide, casein kinase II alpha 1 subunit, CK II alpha, CK2 catalytic subunit alpha, CK2A1casein kinase II subunit alpha, CKII, EC 2.7.11, EC 2.7.11.1, protein kinase CK2
• Host Species: Rabbit
• Molecular Weight of Antigen: 45 kDa
• Quantity: 100 μL
• Research Discipline: Cancer, Cell Cycle and Replication, DNA Repair, Protein Kinase, Signal Transduction, Wnt Signaling Pathway
• Gene ID (Entrez): 1457
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P68400
• Gene Symbols: CSNK2A1
• Immunogen: Synthetic peptides corresponding to CSNK2A1(casein kinase 2, alpha 1 polypeptide) The peptide sequence was selected from the middle region of CSNK2A1. Peptide sequence LGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDP.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: alpha.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish
• Isotype: IgG

For Research Use Only