Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

chemokine (C-C motif) ligand 13, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human CCL13 protein.

Manufacturer:  Abnova Corporation H00006357B01

Catalog No. 89-006-205


Add to cart

Description

Description

This gene is one of several Cys-Cys (CC) cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for monocytes, lymphocytes, basophils and eosinophils, but not neutrophils. This chemokine plays a role in accumulation of leukocytes during inflammation. It may also be involved in the recruitment of monocytes into the arterial wall during artherosclerosis. [provided by RefSeq

Sequence: MKVSAVLLCLLLMTAAFNPQGLAQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT
Specifications

Specifications

chemokine (C-C motif) ligand 13
Unconjugated
No additive
NM_005408
CKb10|MCP-4|MGC17134|NCC-1|NCC1|SCYA13|SCYL1
Mouse
50 uL
Membrane Receptors
Y
Polyclonal
Human
Western Blot
Mouse polyclonal antibody raised against a full-length human CCL13 protein.
CCL13
Serum
CCL13
CCL13 (NP_005399, 1 a.a. ~ 98 a.a) full-length human protein.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
6357
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit