Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

anti-CCL5/RANTES, Polyclonal, Novus Biologicals™

Manufacturer:  Novus Biologicals NBP180236

Catalog No. NBP180236

This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000.


Specifications

Specifications

CCL5/RANTES
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Purified
CCL5
Synthetic peptide directed towards the middle region of mouse CCL5. Peptide sequence YGSDTTPCCFAYLSLELPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCAN.
10 kDa
100ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 1:1000
NP_038681
chemokine (C-C motif) ligand 5, D17S136Enormally T-expressed, and presumably secreted, EoCP, Eosinophil chemotactic cytokine, SIS-delta, small inducible cytokine A5 (RANTES), small inducible cytokine subfamily A (Cys-Cys), member 5, Small-inducible cytokine A5, T cell-specific protein P228, T-cell specific protein p288, TCP228T-cell-specific protein RANTES
Rabbit
IgG
Protein A purified
RUO
Primary
6352
Mouse
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only