Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

anti-CD47, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP232031

Catalog No. NBP232031


Add to cart

Description

Description

CD47 Polyclonal antibody specifically detects CD47 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

CD47
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Affinity Purified
CD47
This antibody was developed against a recombinant protein corresponding to amino acids: AQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVS
Immunogen affinity purified
RUO
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunohistochemistry, Immunohistochemistry (Paraffin)
Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Q08722
antigen identified by monoclonal 1D8, Antigenic surface determinant protein OA3, CD47 antigen, CD47 antigen (Rh-related antigen, integrin-associated signal transducer), CD47 glycoprotein, CD47 molecule, IAPintegrin associated protein, Integrin-associated protein, leukocyte surface antigen CD47, MER6integrin-associated signal transducer, OA3, Protein MER6, Rh-related antigen
Rabbit
IgG
0.1 ml
Immunology, Signal Transduction
Primary
961
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only