CDK4, Mouse, Clone: 3E7, Abnova™

Mouse monoclonal antibody raised against a partial recombinant CDK4.

Manufacturer: Abnova Corporation H00001019M08

Catalog No. 89-021-025

  Check Availability
Add to Cart

    Specifications

    Antigen CDK4
    Applications Enzyme Linked Immunosorbent Assay,Western Blotting
    Clone 3E7
    Conjugate Unlabeled
    Cross Reactivity Human
    Description cyclin-dependent kinase 4
    Format Liquid
    Formulation In 1X PBS, pH 7.4
    Gene CDK4
    Gene Accession No. BC003644
    Gene Alias CMM3, MGC14458, PSK-J3
    Gene Symbols CDK4
    Host Species Mouse
    Immunogen CDK4 (AAH03644, 211 a.a. ∽304 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26kDa
    Isotype IgG2b, κ
    Quantity 100μg
    Regulatory Status RUO
    Species Reactivity Human
    Storage Requirements Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
    Primary or Secondary Primary
    Monoclonal or Polyclonal Monoclonal
    Gene ID (Entrez) 1019

    The protein encoded by this gene is a member of the Ser/Thr protein kinase family. This protein is highly similar to the gene products of S. cerevisiae cdc28 and S. pombe cdc2. It is a catalytic subunit of the protein kinase complex that is important for cell cycle G1 phase progression. The activity of this kinase is restricted to the G1-S phase, which is controlled by the regulatory subunits D-type cyclins and CDK inhibitor p16(INK4a). This kinase was shown to be responsible for the phosphorylation of retinoblastoma gene product (Rb). Mutations in this gene as well as in its related proteins including D-type cyclins, p16(INK4a) and Rb were all found to be associated with tumorigenesis of a variety of cancers. Multiple polyadenylation sites of this gene have been reported. [provided by RefSeq

    Sequence: KPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE

  • Description & Specifications

Related Products


Product Content Feedback

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit