Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

cyclin-dependent kinase inhibitor 1B (p27, Kip1) (B01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human CDKN1B protein.

Manufacturer:  Abnova Corporation H00001027B01

Catalog No. 89-005-109


Add to cart

Description

Description

This gene encodes a cyclin-dependent kinase inhibitor, which shares a limited similarity with CDK inhibitor CDKN1A/p21. The encoded protein binds to and prevents the activation of cyclin E-CDK2 or cyclin D-CDK4 complexes, and thus controls the cell cycle progression at G1. The degradation of this protein, which is triggered by its CDK dependent phosphorylation and subsequent ubiquitination by SCF complexes, is required for the cellular transition from quiescence to the proliferative state. [provided by RefSeq

Sequence: MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDGSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATGDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT
Specifications

Specifications

cyclin-dependent kinase inhibitor 1B (p27, Kip1)
Unconjugated
No additive
BC001971
CDKN4|KIP1|MEN1B|MEN4|P27KIP1
Mouse
50 uL
Cell Cycle
Y
Polyclonal
Human
Immunofluorescence, Western Blot
Mouse polyclonal antibody raised against a full-length human CDKN1B protein.
CDKN1B
Serum
CDKN1B
CDKN1B (AAH01971, 1 a.a. ~ 198 a.a) full-length human protein.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
1027
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit