Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human CDKN2D protein.

Manufacturer:  Abnova Corporation H00001032B02

Catalog No. 89-005-114


Add to cart

Description

Description

The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to form a stable complex with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that controls cell cycle G1 progression. The abundance of the transcript of this gene was found to oscillate in a cell-cycle dependent manner with the lowest expression at mid G1 and a maximal expression during S phase. The negative regulation of the cell cycle involved in this protein was shown to participate in repressing neuronal proliferation, as well as spermatogenesis. Two alternatively spliced variants of this gene, which encode an identical protein, have been reported. [provided by RefSeq

Sequence: MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL
Specifications

Specifications

cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4)
Unconjugated
No additive
NM_001800
INK4D|p19|p19-INK4D
Mouse
50 uL
Cell Cycle
Y
Polyclonal
Human
Western Blot
Mouse polyclonal antibody raised against a full-length human CDKN2D protein.
CDKN2D
Serum
CDKN2D
CDKN2D (NP_001791, 1 a.a. ~ 166 a.a) full-length human protein.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
1032
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit