Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ceramide kinase (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length recombinant CERK.

Manufacturer:  Abnova Corporation H00064781A01

Catalog No. 89-004-710


Add to cart

Description

Description

CERK converts ceramide to ceramide 1-phosphate (C1P), a sphingolipid metabolite. Both CERK and C1P have been implicated in various cellular processes, including proliferation, apoptosis, phagocytosis, and inflammation (Kim et al., 2006 [PubMed 16488390]).[supplied by OMIM

Sequence: MQRGPASGDPREGPPRQRREGCWGLHTCLITAARLRQSGWEHDLGVCSGSTDDKLWKLAVCKALASLLLLKCQIPMLYIDAKCLTQPGLGAVRRKLAIRGGGAGPGLPQDSSEAGPEVCTRGPDLSLSFLHTEFSIFIEHLVLLSQSSVNCVSDVCLLPRSHDGSLVSSAARGLRRPEDSSRKAFLPRSPGHPSIVYYVLV
Specifications

Specifications

ceramide kinase
Unconjugated
50% glycerol
BC004278
DKFZp434E0211|FLJ21430|FLJ23239|KIAA1646|LK4|MGC131878|dA59H18.2|dA59H18.3|hCERK
Mouse
50 uL
Endocrine/Metabolism
Y
Polyclonal
Human
ELISA, Western Blot
Mouse polyclonal antibody raised against a full-length recombinant CERK.
CERK
Serum
CERK
CERK (AAH04278, 1 a.a. ~ 201 a.a) full-length recombinant protein with GST tag.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
64781
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit