Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CHD4, Mouse, Clone: 4H4, Abnova™

Mouse monoclonal antibody raised against a partial recombinant CHD4.

Manufacturer:  Abnova Corporation H00001108M01A

Catalog No. 89-021-074


  Check Availability
Add to cart

Specifications

Description

The product of this gene belongs to the SNF2/RAD54 helicase family. It represents the main component of the nucleosome remodeling and deacetylase complex and plays an important role in epigenetic transcriptional repression. Patients with dermatomyositis develop antibodies against this protein. [provided by RefSeq

Sequence: ETEPKGAADVEKVEEKSAIDLTPIVVEDKEEKKEEEEKKEVMLQNGETPKDLNDEKQKKNIKQRFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWH
Description & Specifications

Specifications

CHD4
4H4
Human
Ascites
CHD4
DKFZp686E06161, Mi-2b, Mi2-BETA
Murine
IgG2a, κ
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Monoclonal
Human
ELISA,Immunohistochemistry,Sandwich ELISA,Western Blot
Unlabeled
chromodomain helicase DNA binding protein 4
In ascites fluid
NM_001273
CHD4
CHD4 (NP_001264, 1632 a.a. ∽1731 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26kDa
200μL
Human
Primary
1108
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit