CHD4, Mouse, Clone: 4H4, Abnova™

Mouse monoclonal antibody raised against a partial recombinant CHD4.

Manufacturer: Abnova Corporation H00001108M01A

Catalog No. 89-021-074

  Check Availability
Add to Cart

    Specifications

    Antigen CHD4
    Applications Enzyme Linked Immunosorbent Assay,Immunohistochemistry,Sandwich ELISA,Western Blotting
    Clone 4H4
    Conjugate Unlabeled
    Cross Reactivity Human
    Description chromodomain helicase DNA binding protein 4
    Format Ascites
    Formulation In ascites fluid
    Gene CHD4
    Gene Accession No. NM_001273
    Gene Alias DKFZp686E06161, Mi-2b, Mi2-BETA
    Gene Symbols CHD4
    Host Species Mouse
    Immunogen CHD4 (NP_001264, 1632 a.a. ∽1731 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26kDa
    Isotype IgG2a, κ
    Quantity 200μL
    Regulatory Status RUO
    Species Reactivity Human
    Storage Requirements Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
    Primary or Secondary Primary
    Monoclonal or Polyclonal Monoclonal
    Gene ID (Entrez) 1108

    The product of this gene belongs to the SNF2/RAD54 helicase family. It represents the main component of the nucleosome remodeling and deacetylase complex and plays an important role in epigenetic transcriptional repression. Patients with dermatomyositis develop antibodies against this protein. [provided by RefSeq

    Sequence: ETEPKGAADVEKVEEKSAIDLTPIVVEDKEEKKEEEEKKEVMLQNGETPKDLNDEKQKKNIKQRFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWH

  • Description & Specifications

Related Products


Product Content Feedback

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit