CHMP2A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP191780

Catalog No. NBP191780

Description

CHMP2A Polyclonal specifically detects CHMP2A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CHMP2A
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Alias: BC-2, BC2VPS2 homolog A, CHMP2a, CHMP2hVps2-1, chromatin modifying protein 2A, Chromatin-modifying protein 2a, Putative breast adenocarcinoma marker BC-2, Vacuolar protein sorting-associated protein 2-1, vps2-1, VPS2Aputative breast adenocarcinoma marker (32kD), VPS2charged multivesicular body protein 2a
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 27243
• Target Species: Human, Mouse, Rat
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: CHMP2A
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:NIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQIQKIMMEFERQAEIMDMKEEMMNDAIDDAM
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only